Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879
  1. Avatar for ViJay7019 81. ViJay7019 Lv 1 1 pt. 9,276
  2. Avatar for toshiue 82. toshiue Lv 1 1 pt. 9,258
  3. Avatar for pfeiffelfloyd 83. pfeiffelfloyd Lv 1 1 pt. 9,225
  4. Avatar for uihcv 84. uihcv Lv 1 1 pt. 9,223
  5. Avatar for Arne Heessels 85. Arne Heessels Lv 1 1 pt. 9,166
  6. Avatar for drjr 86. drjr Lv 1 1 pt. 9,111
  7. Avatar for Knoblerine 87. Knoblerine Lv 1 1 pt. 9,111
  8. Avatar for goodger 88. goodger Lv 1 1 pt. 9,069
  9. Avatar for Ricardo Oliveira 89. Ricardo Oliveira Lv 1 1 pt. 9,061
  10. Avatar for petetrig 90. petetrig Lv 1 1 pt. 9,023

Comments