Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,618
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,474
  3. Avatar for Go Science 3. Go Science 44 pts. 10,455
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 10,447
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,439
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,400
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,322
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,189
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,731
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 2 pts. 10,424
  2. Avatar for Hollinas 12. Hollinas Lv 1 1 pt. 10,412
  3. Avatar for Blipperman 13. Blipperman Lv 1 1 pt. 10,385
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 1 pt. 10,374
  5. Avatar for sciencewalker 15. sciencewalker Lv 1 1 pt. 10,295
  6. Avatar for Vincera 16. Vincera Lv 1 1 pt. 10,084
  7. Avatar for isaksson 17. isaksson Lv 1 1 pt. 10,069
  8. Avatar for Anfinsen_slept_here 18. Anfinsen_slept_here Lv 1 1 pt. 10,028
  9. Avatar for alwen 19. alwen Lv 1 1 pt. 9,592

Comments