Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,618
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,474
  3. Avatar for Go Science 3. Go Science 44 pts. 10,455
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 10,447
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,439
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,400
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,322
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,189
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,731

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 10,614
  2. Avatar for Aubade01 2. Aubade01 Lv 1 97 pts. 10,610
  3. Avatar for bertro 3. bertro Lv 1 93 pts. 10,596
  4. Avatar for LociOiling 4. LociOiling Lv 1 89 pts. 10,591
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 86 pts. 10,569
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 82 pts. 10,466
  7. Avatar for phi16 7. phi16 Lv 1 79 pts. 10,460
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 76 pts. 10,455
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 73 pts. 10,449
  10. Avatar for actiasluna 10. actiasluna Lv 1 70 pts. 10,447

Comments