Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,775
  2. Avatar for smilingone 2. smilingone Lv 1 77 pts. 9,766
  3. Avatar for Galaxie 3. Galaxie Lv 1 58 pts. 9,702
  4. Avatar for phi16 4. phi16 Lv 1 43 pts. 9,696
  5. Avatar for robgee 5. robgee Lv 1 31 pts. 9,694
  6. Avatar for alwen 6. alwen Lv 1 22 pts. 9,681
  7. Avatar for alcor29 7. alcor29 Lv 1 15 pts. 9,674
  8. Avatar for ManVsYard 8. ManVsYard Lv 1 11 pts. 9,658
  9. Avatar for reefyrob 9. reefyrob Lv 1 7 pts. 9,636
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 5 pts. 9,635

Comments