Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for georg137
    1. georg137 Lv 1
    100 pts. 9,992
  2. Avatar for reefyrob 2. reefyrob Lv 1 97 pts. 9,765
  3. Avatar for Galaxie 3. Galaxie Lv 1 93 pts. 9,702
  4. Avatar for johnmitch 4. johnmitch Lv 1 89 pts. 9,696
  5. Avatar for actiasluna 5. actiasluna Lv 1 85 pts. 9,681
  6. Avatar for bertro 6. bertro Lv 1 82 pts. 9,678
  7. Avatar for frood66 7. frood66 Lv 1 79 pts. 9,667
  8. Avatar for LociOiling 8. LociOiling Lv 1 75 pts. 9,665
  9. Avatar for O Seki To 9. O Seki To Lv 1 72 pts. 9,643
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 69 pts. 9,621

Comments