Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,351
  2. Avatar for Stuyvesant Molecular Science 2017-18 12. Stuyvesant Molecular Science 2017-18 1 pt. 8,060
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 5,878
  1. Avatar for kludbrook 91. kludbrook Lv 1 1 pt. 8,236
  2. Avatar for Rastamasta 92. Rastamasta Lv 1 1 pt. 8,185
  3. Avatar for NotJim99 93. NotJim99 Lv 1 1 pt. 8,178
  4. Avatar for multaq 94. multaq Lv 1 1 pt. 8,172
  5. Avatar for Knoblerine 95. Knoblerine Lv 1 1 pt. 8,145
  6. Avatar for SouperGenious 96. SouperGenious Lv 1 1 pt. 8,120
  7. Avatar for lamoille 97. lamoille Lv 1 1 pt. 8,097
  8. Avatar for Might-o-chondria 98. Might-o-chondria Lv 1 1 pt. 8,060
  9. Avatar for rinze 99. rinze Lv 1 1 pt. 8,057
  10. Avatar for roman madala 100. roman madala Lv 1 1 pt. 8,051

Comments