Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 42 pts. 9,508
  2. Avatar for ZeroLeak7 22. ZeroLeak7 Lv 1 40 pts. 9,503
  3. Avatar for smilingone 23. smilingone Lv 1 38 pts. 9,486
  4. Avatar for pvc78 24. pvc78 Lv 1 37 pts. 9,482
  5. Avatar for robgee 25. robgee Lv 1 35 pts. 9,467
  6. Avatar for fpc 26. fpc Lv 1 33 pts. 9,463
  7. Avatar for TastyMunchies 27. TastyMunchies Lv 1 32 pts. 9,463
  8. Avatar for veroxdraco 28. veroxdraco Lv 1 30 pts. 9,456
  9. Avatar for Flagg65a 29. Flagg65a Lv 1 29 pts. 9,449
  10. Avatar for isaksson 30. isaksson Lv 1 27 pts. 9,448

Comments