Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for Bruno Kestemont 41. Bruno Kestemont Lv 1 15 pts. 9,244
  2. Avatar for WBarme1234 42. WBarme1234 Lv 1 14 pts. 9,232
  3. Avatar for nicobul 43. nicobul Lv 1 13 pts. 9,213
  4. Avatar for DoctorSockrates 44. DoctorSockrates Lv 1 13 pts. 9,154
  5. Avatar for Psych0Active 45. Psych0Active Lv 1 12 pts. 9,149
  6. Avatar for Jesse Pinkman 46. Jesse Pinkman Lv 1 11 pts. 9,140
  7. Avatar for tarimo 47. tarimo Lv 1 11 pts. 9,138
  8. Avatar for dbuske 48. dbuske Lv 1 10 pts. 9,114
  9. Avatar for alwen 49. alwen Lv 1 9 pts. 9,111
  10. Avatar for goodger 50. goodger Lv 1 9 pts. 9,109

Comments