Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for alcor29 51. alcor29 Lv 1 8 pts. 9,083
  2. Avatar for Vincera 52. Vincera Lv 1 8 pts. 9,065
  3. Avatar for petetrig 53. petetrig Lv 1 7 pts. 9,064
  4. Avatar for Threeoak 54. Threeoak Lv 1 7 pts. 9,062
  5. Avatar for anthion 55. anthion Lv 1 6 pts. 9,028
  6. Avatar for toshiue 57. toshiue Lv 1 6 pts. 8,984
  7. Avatar for ManVsYard 58. ManVsYard Lv 1 5 pts. 8,970
  8. Avatar for Deleted player 59. Deleted player pts. 8,969
  9. Avatar for GetOffMyLawn 60. GetOffMyLawn Lv 1 5 pts. 8,918

Comments