Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for Ricardo Oliveira 81. Ricardo Oliveira Lv 1 1 pt. 8,373
  2. Avatar for drjr 82. drjr Lv 1 1 pt. 8,372
  3. Avatar for sciencewalker 83. sciencewalker Lv 1 1 pt. 8,354
  4. Avatar for versat82 84. versat82 Lv 1 1 pt. 8,351
  5. Avatar for Deleted player 85. Deleted player pts. 8,346
  6. Avatar for silent gene 86. silent gene Lv 1 1 pt. 8,341
  7. Avatar for mitarcher 87. mitarcher Lv 1 1 pt. 8,335
  8. Avatar for boondog 88. boondog Lv 1 1 pt. 8,274
  9. Avatar for badgoes 89. badgoes Lv 1 1 pt. 8,258
  10. Avatar for Kiwegapa 90. Kiwegapa Lv 1 1 pt. 8,244

Comments