Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Contenders 100 pts. 9,992
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,702
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 9,681
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,667
  6. Avatar for HMT heritage 6. HMT heritage 7 pts. 9,643
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,617
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,611
  9. Avatar for Go Science 9. Go Science 1 pt. 9,588
  10. Avatar for freefolder 10. freefolder 1 pt. 8,406

  1. Avatar for Blipperman 11. Blipperman Lv 1 3 pts. 9,634
  2. Avatar for lamoille 12. lamoille Lv 1 2 pts. 9,587
  3. Avatar for toshiue 13. toshiue Lv 1 1 pt. 9,568
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 1 pt. 9,563
  5. Avatar for Hollinas 15. Hollinas Lv 1 1 pt. 9,537
  6. Avatar for sciencewalker 16. sciencewalker Lv 1 1 pt. 9,517
  7. Avatar for JMStiffler 17. JMStiffler Lv 1 1 pt. 9,433
  8. Avatar for ViJay7019 18. ViJay7019 Lv 1 1 pt. 9,354
  9. Avatar for Alistair69 19. Alistair69 Lv 1 1 pt. 9,155
  10. Avatar for Vincera 20. Vincera Lv 1 1 pt. 9,035

Comments