Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Contenders 100 pts. 9,992
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,702
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 9,681
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,667
  6. Avatar for HMT heritage 6. HMT heritage 7 pts. 9,643
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,617
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,611
  9. Avatar for Go Science 9. Go Science 1 pt. 9,588
  10. Avatar for freefolder 10. freefolder 1 pt. 8,406

  1. Avatar for sboy171772 111. sboy171772 Lv 1 1 pt. 7,742
  2. Avatar for manu8170 112. manu8170 Lv 1 1 pt. 7,652
  3. Avatar for JellyJump 113. JellyJump Lv 1 1 pt. 7,558
  4. Avatar for plasterosporanny 114. plasterosporanny Lv 1 1 pt. 7,518
  5. Avatar for JMStiffler 115. JMStiffler Lv 1 1 pt. 7,329
  6. Avatar for josh00 116. josh00 Lv 1 1 pt. 7,318
  7. Avatar for nbbanker 117. nbbanker Lv 1 1 pt. 7,289
  8. Avatar for alyssajoyh 118. alyssajoyh Lv 1 1 pt. 5,962
  9. Avatar for funf 119. funf Lv 1 1 pt. 5,883
  10. Avatar for Felix12356 120. Felix12356 Lv 1 1 pt. 5,879

Comments