Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,371
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 97 pts. 10,273
  3. Avatar for actiasluna 3. actiasluna Lv 1 93 pts. 10,240
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 89 pts. 10,239
  5. Avatar for TastyMunchies 5. TastyMunchies Lv 1 86 pts. 10,194
  6. Avatar for Galaxie 6. Galaxie Lv 1 83 pts. 10,180
  7. Avatar for crpainter 7. crpainter Lv 1 79 pts. 10,171
  8. Avatar for anthion 8. anthion Lv 1 76 pts. 10,167
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 73 pts. 10,155
  10. Avatar for frood66 10. frood66 Lv 1 70 pts. 10,129

Comments