Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Beta Folders 100 pts. 10,371
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 10,273
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,240
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 30 pts. 10,180
  5. Avatar for Contenders 5. Contenders 19 pts. 10,171
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,134
  7. Avatar for Go Science 7. Go Science 7 pts. 10,122
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 10,100
  9. Avatar for HMT heritage 9. HMT heritage 2 pts. 9,930
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,603

  1. Avatar for phi16 11. phi16 Lv 1 6 pts. 10,158
  2. Avatar for robgee 12. robgee Lv 1 4 pts. 10,136
  3. Avatar for jausmh 13. jausmh Lv 1 3 pts. 10,134
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 2 pts. 10,122
  5. Avatar for alwen 15. alwen Lv 1 1 pt. 10,121
  6. Avatar for alcor29 16. alcor29 Lv 1 1 pt. 10,119
  7. Avatar for pauldunn 17. pauldunn Lv 1 1 pt. 10,102
  8. Avatar for toshiue 18. toshiue Lv 1 1 pt. 10,099
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 1 pt. 10,090
  10. Avatar for sciencewalker 20. sciencewalker Lv 1 1 pt. 10,083

Comments