Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612
  1. Avatar for hpaege
    1. hpaege Lv 1
    100 pts. 10,113
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 97 pts. 10,091
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 94 pts. 10,080
  4. Avatar for smilingone 4. smilingone Lv 1 90 pts. 10,064
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 87 pts. 10,060
  6. Avatar for LociOiling 6. LociOiling Lv 1 84 pts. 10,052
  7. Avatar for Idiotboy 7. Idiotboy Lv 1 81 pts. 10,037
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 78 pts. 10,031
  9. Avatar for crpainter 9. crpainter Lv 1 75 pts. 9,990
  10. Avatar for Deleted player 10. Deleted player pts. 9,984

Comments