Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 8,515
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,612

  1. Avatar for jausmh
    1. jausmh Lv 1
    100 pts. 10,101
  2. Avatar for LociOiling 2. LociOiling Lv 1 68 pts. 10,083
  3. Avatar for reefyrob 3. reefyrob Lv 1 44 pts. 10,069
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 27 pts. 10,063
  5. Avatar for smilingone 5. smilingone Lv 1 16 pts. 10,062
  6. Avatar for toshiue 6. toshiue Lv 1 9 pts. 10,025
  7. Avatar for Paulo Roque 7. Paulo Roque Lv 1 5 pts. 10,024
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 3 pts. 10,020
  9. Avatar for Galaxie 9. Galaxie Lv 1 1 pt. 9,998
  10. Avatar for lamoille 10. lamoille Lv 1 1 pt. 9,979

Comments