Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Marvin's bunch 100 pts. 10,101
  2. Avatar for Contenders 2. Contenders 63 pts. 10,091
  3. Avatar for Beta Folders 3. Beta Folders 37 pts. 10,083
  4. Avatar for Go Science 4. Go Science 21 pts. 10,031
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 9,998
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 9,952
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,906
  8. Avatar for Russian team 8. Russian team 1 pt. 9,496
  9. Avatar for freefolder 9. freefolder 1 pt. 8,594
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,518

  1. Avatar for atlas100 101. atlas100 Lv 1 1 pt. 7,996
  2. Avatar for lamoille 102. lamoille Lv 1 1 pt. 7,948
  3. Avatar for Paulo Roque 103. Paulo Roque Lv 1 1 pt. 7,904
  4. Avatar for sir_arcane 104. sir_arcane Lv 1 1 pt. 7,871
  5. Avatar for Jeacom512 105. Jeacom512 Lv 1 1 pt. 7,826
  6. Avatar for Petrifolder 106. Petrifolder Lv 1 1 pt. 7,786
  7. Avatar for trebach 107. trebach Lv 1 1 pt. 7,779
  8. Avatar for parsnip 108. parsnip Lv 1 1 pt. 7,737
  9. Avatar for paulcianci 109. paulcianci Lv 1 1 pt. 7,725
  10. Avatar for west.elsdon 110. west.elsdon Lv 1 1 pt. 7,723

Comments