Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 10,101
  2. Avatar for Contenders 2. Contenders 63 pts. 10,091
  3. Avatar for Beta Folders 3. Beta Folders 37 pts. 10,083
  4. Avatar for Go Science 4. Go Science 21 pts. 10,031
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 9,998
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 9,952
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,906
  8. Avatar for Russian team 8. Russian team 1 pt. 9,496
  9. Avatar for freefolder 9. freefolder 1 pt. 8,594
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,518
  1. Avatar for navneetsandhu 131. navneetsandhu Lv 1 1 pt. 6,692
  2. Avatar for bkoep 132. bkoep Lv 1 1 pt. 3,334
  3. Avatar for altejoh 133. altejoh Lv 1 1 pt. 3,334
  4. Avatar for Museka 134. Museka Lv 1 1 pt. 3,334
  5. Avatar for rmoretti 135. rmoretti Lv 1 1 pt. 3,334
  6. Avatar for uihcv 136. uihcv Lv 1 1 pt. 3,334
  7. Avatar for alitzelcg 137. alitzelcg Lv 1 1 pt. 3,334
  8. Avatar for leysanguyen 138. leysanguyen Lv 1 1 pt. 3,334
  9. Avatar for Hollinas 139. Hollinas Lv 1 1 pt. 3,334
  10. Avatar for AnaVillanueva18 140. AnaVillanueva18 Lv 1 1 pt. 3,334

Comments