Placeholder image of a protein
Icon representing a puzzle

1575: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 10,101
  2. Avatar for Contenders 2. Contenders 63 pts. 10,091
  3. Avatar for Beta Folders 3. Beta Folders 37 pts. 10,083
  4. Avatar for Go Science 4. Go Science 21 pts. 10,031
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 9,998
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 9,952
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,906
  8. Avatar for Russian team 8. Russian team 1 pt. 9,496
  9. Avatar for freefolder 9. freefolder 1 pt. 8,594
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,518
  1. Avatar for guineapig 21. guineapig Lv 1 47 pts. 9,871
  2. Avatar for 181818 22. 181818 Lv 1 45 pts. 9,870
  3. Avatar for stomjoh 23. stomjoh Lv 1 44 pts. 9,869
  4. Avatar for johnmitch 24. johnmitch Lv 1 42 pts. 9,846
  5. Avatar for pvc78 25. pvc78 Lv 1 40 pts. 9,794
  6. Avatar for isaksson 26. isaksson Lv 1 38 pts. 9,787
  7. Avatar for robgee 27. robgee Lv 1 37 pts. 9,765
  8. Avatar for georg137 28. georg137 Lv 1 35 pts. 9,761
  9. Avatar for tarimo 29. tarimo Lv 1 34 pts. 9,760
  10. Avatar for Vinara 30. Vinara Lv 1 32 pts. 9,757

Comments