Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 12,435
  2. Avatar for Galaxie 2. Galaxie Lv 1 97 pts. 12,429
  3. Avatar for tyler0911 3. tyler0911 Lv 1 93 pts. 12,122
  4. Avatar for reefyrob 4. reefyrob Lv 1 89 pts. 12,104
  5. Avatar for Deleted player 5. Deleted player pts. 12,070
  6. Avatar for crpainter 6. crpainter Lv 1 83 pts. 12,029
  7. Avatar for LociOiling 7. LociOiling Lv 1 79 pts. 11,993
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 76 pts. 11,885
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 73 pts. 11,839
  10. Avatar for pauldunn 10. pauldunn Lv 1 70 pts. 11,837

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV