Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0

  1. Avatar for Paulo Roque 91. Paulo Roque Lv 1 1 pt. 6,310
  2. Avatar for smilingone 92. smilingone Lv 1 1 pt. 6,260
  3. Avatar for Flagg65a 93. Flagg65a Lv 1 1 pt. 6,181
  4. Avatar for drjr 94. drjr Lv 1 1 pt. 6,170
  5. Avatar for asb4 95. asb4 Lv 1 1 pt. 5,980
  6. Avatar for Sydefecks 96. Sydefecks Lv 1 1 pt. 5,848
  7. Avatar for lconor 97. lconor Lv 1 1 pt. 5,699
  8. Avatar for tjonesster 98. tjonesster Lv 1 1 pt. 5,674
  9. Avatar for Wipf 99. Wipf Lv 1 1 pt. 5,565
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 5,313

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV