Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0

  1. Avatar for lamoille 111. lamoille Lv 1 1 pt. 2,305
  2. Avatar for Bautho 112. Bautho Lv 1 1 pt. 1,997
  3. Avatar for JohnCloud 113. JohnCloud Lv 1 1 pt. 0
  4. Avatar for jwilson04 114. jwilson04 Lv 1 1 pt. 0
  5. Avatar for 01010011111 115. 01010011111 Lv 1 1 pt. 0
  6. Avatar for chaper1 116. chaper1 Lv 1 1 pt. 0
  7. Avatar for Marvelz 117. Marvelz Lv 1 1 pt. 0
  8. Avatar for shuleh 118. shuleh Lv 1 1 pt. 0
  9. Avatar for ingoneato 119. ingoneato Lv 1 1 pt. 0
  10. Avatar for Mao Mao 120. Mao Mao Lv 1 1 pt. 0

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV