Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 0
  1. Avatar for brandyt1334 121. brandyt1334 Lv 1 1 pt. 0
  2. Avatar for Susume 122. Susume Lv 1 1 pt. 0
  3. Avatar for Hollinas 123. Hollinas Lv 1 1 pt. 0
  4. Avatar for rmoretti 124. rmoretti Lv 1 1 pt. 0
  5. Avatar for Ciccillo 125. Ciccillo Lv 1 1 pt. 0
  6. Avatar for Space_warf 126. Space_warf Lv 1 1 pt. 0
  7. Avatar for veracidhawk 127. veracidhawk Lv 1 1 pt. 0
  8. Avatar for justjustin 128. justjustin Lv 1 1 pt. 0
  9. Avatar for phi16 129. phi16 Lv 1 1 pt. 0
  10. Avatar for bkoep 130. bkoep Lv 1 1 pt. 0

Comments

Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV