Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,108
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 7,737
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,400
  4. Avatar for Deleted group 14. Deleted group pts. 2,412
  5. Avatar for incognito group 15. incognito group 1 pt. 0

  1. Avatar for Deleted player 61. Deleted player pts. 8,481
  2. Avatar for Altercomp 62. Altercomp Lv 1 5 pts. 8,408
  3. Avatar for Alistair69 63. Alistair69 Lv 1 4 pts. 8,254
  4. Avatar for cobaltteal 64. cobaltteal Lv 1 4 pts. 8,235
  5. Avatar for Merf 65. Merf Lv 1 4 pts. 8,155
  6. Avatar for fisherlr777 66. fisherlr777 Lv 1 4 pts. 8,139
  7. Avatar for vakobo 67. vakobo Lv 1 3 pts. 8,108
  8. Avatar for toshiue 68. toshiue Lv 1 3 pts. 8,072
  9. Avatar for ppp6 69. ppp6 Lv 1 3 pts. 8,033
  10. Avatar for Mike Cassidy 70. Mike Cassidy Lv 1 3 pts. 7,988

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV