Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Beta Folders 100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408

  1. Avatar for silent gene 11. silent gene Lv 1 2 pts. 11,739
  2. Avatar for nicobul 12. nicobul Lv 1 1 pt. 11,723
  3. Avatar for sciencewalker 13. sciencewalker Lv 1 1 pt. 11,704
  4. Avatar for Paulo Roque 14. Paulo Roque Lv 1 1 pt. 11,704
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 1 pt. 11,658
  6. Avatar for retiredmichael 16. retiredmichael Lv 1 1 pt. 11,606
  7. Avatar for smilingone 17. smilingone Lv 1 1 pt. 11,590
  8. Avatar for georg137 18. georg137 Lv 1 1 pt. 11,407
  9. Avatar for Deleted player 19. Deleted player pts. 8,683

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV