Bletchley Park Lv 1
This puzzle is not showing up in the puzzle download menu. 20180829-6ed3ad0d20-win_x86
Closed since over 7 years ago
Intermediate Intermediate Overall Overall Prediction PredictionThis bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.
This puzzle is not showing up in the puzzle download menu. 20180829-6ed3ad0d20-win_x86
where is the sequence - not shown on this page (which is de rigour these days)
SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV
Many people have been able to play this one, are you still getting that error?
Thank you Susume for posting it so quickly!
I can now load it, thank you !
I believe that sometimes it posts to the website but takes longer to sync up with the client.