Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Beta Folders 100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408

  1. Avatar for Paulo Roque 91. Paulo Roque Lv 1 1 pt. 6,310
  2. Avatar for smilingone 92. smilingone Lv 1 1 pt. 6,260
  3. Avatar for Flagg65a 93. Flagg65a Lv 1 1 pt. 6,181
  4. Avatar for drjr 94. drjr Lv 1 1 pt. 6,170
  5. Avatar for asb4 95. asb4 Lv 1 1 pt. 5,980
  6. Avatar for Sydefecks 96. Sydefecks Lv 1 1 pt. 5,848
  7. Avatar for lconor 97. lconor Lv 1 1 pt. 5,699
  8. Avatar for tjonesster 98. tjonesster Lv 1 1 pt. 5,674
  9. Avatar for Wipf 99. Wipf Lv 1 1 pt. 5,565
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 5,313

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV