Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Beta Folders 100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408

  1. Avatar for lamoille 111. lamoille Lv 1 1 pt. 2,305
  2. Avatar for Bautho 112. Bautho Lv 1 1 pt. 1,997
  3. Avatar for JohnCloud 113. JohnCloud Lv 1 1 pt. 0
  4. Avatar for jwilson04 114. jwilson04 Lv 1 1 pt. 0
  5. Avatar for 01010011111 115. 01010011111 Lv 1 1 pt. 0
  6. Avatar for chaper1 116. chaper1 Lv 1 1 pt. 0
  7. Avatar for Marvelz 117. Marvelz Lv 1 1 pt. 0
  8. Avatar for shuleh 118. shuleh Lv 1 1 pt. 0
  9. Avatar for ingoneato 119. ingoneato Lv 1 1 pt. 0
  10. Avatar for Mao Mao 120. Mao Mao Lv 1 1 pt. 0

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV