Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Beta Folders 100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408

  1. Avatar for aznarog 51. aznarog Lv 1 9 pts. 9,364
  2. Avatar for matosfran 52. matosfran Lv 1 9 pts. 9,279
  3. Avatar for ourtown 53. ourtown Lv 1 8 pts. 9,257
  4. Avatar for guineapig 54. guineapig Lv 1 8 pts. 9,162
  5. Avatar for Crossed Sticks 55. Crossed Sticks Lv 1 7 pts. 9,115
  6. Avatar for pfirth 56. pfirth Lv 1 7 pts. 9,079
  7. Avatar for SouperGenious 57. SouperGenious Lv 1 6 pts. 8,969
  8. Avatar for alcor29 58. alcor29 Lv 1 6 pts. 8,841
  9. Avatar for boondog 59. boondog Lv 1 6 pts. 8,784
  10. Avatar for Noah_Quinn 60. Noah_Quinn Lv 1 5 pts. 8,621

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV