Placeholder image of a protein
Icon representing a puzzle

1579: 221-residue Cryo-EM Multi-Start Puzzle

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
October 01, 2018
Expires
Max points
100
Description

This bigger protein is another part of the same protein complex with multiple subunits from Puzzle 1554, which has been the target of cryo-EM experiments. We are giving you 5 different server predictions as starting points. Reset the puzzle to cycle through the different starting models.

Top groups


  1. Avatar for Beta Folders 100 pts. 12,453
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,429
  3. Avatar for Contenders 3. Contenders 49 pts. 12,029
  4. Avatar for Go Science 4. Go Science 33 pts. 11,885
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,730
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 11,543
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,450
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 10,510
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 9,924
  10. Avatar for freefolder 10. freefolder 2 pts. 8,408

  1. Avatar for Deleted player 61. Deleted player pts. 8,481
  2. Avatar for Altercomp 62. Altercomp Lv 1 5 pts. 8,408
  3. Avatar for Alistair69 63. Alistair69 Lv 1 4 pts. 8,254
  4. Avatar for cobaltteal 64. cobaltteal Lv 1 4 pts. 8,235
  5. Avatar for Merf 65. Merf Lv 1 4 pts. 8,155
  6. Avatar for fisherlr777 66. fisherlr777 Lv 1 4 pts. 8,139
  7. Avatar for vakobo 67. vakobo Lv 1 3 pts. 8,108
  8. Avatar for toshiue 68. toshiue Lv 1 3 pts. 8,072
  9. Avatar for ppp6 69. ppp6 Lv 1 3 pts. 8,033
  10. Avatar for Mike Cassidy 70. Mike Cassidy Lv 1 3 pts. 7,988

Comments


Susume Lv 1

SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV