Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 8,763
  2. Avatar for Minions of TWIS 12. Minions of TWIS 1 pt. 8,711
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,709
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,652
  5. Avatar for freefolder 15. freefolder 1 pt. 8,333

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 10,426
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,356
  3. Avatar for Timo van der Laan 3. Timo van der Laan Lv 1 93 pts. 10,352
  4. Avatar for Galaxie 4. Galaxie Lv 1 90 pts. 10,324
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 87 pts. 10,310
  6. Avatar for frood66 6. frood66 Lv 1 84 pts. 10,268
  7. Avatar for reefyrob 7. reefyrob Lv 1 81 pts. 10,255
  8. Avatar for Aubade01 8. Aubade01 Lv 1 78 pts. 10,169
  9. Avatar for hpaege 9. hpaege Lv 1 75 pts. 10,162
  10. Avatar for guineapig 10. guineapig Lv 1 72 pts. 10,153

Comments