Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,440
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 10,352
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 10,324
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,298
  5. Avatar for Go Science 5. Go Science 22 pts. 10,172
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,115
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,109
  8. Avatar for Contenders 8. Contenders 5 pts. 9,982
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,743
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 2 pts. 8,794

  1. Avatar for kdratstn 132. kdratstn Lv 1 1 pt. 7,130
  2. Avatar for acole001 133. acole001 Lv 1 1 pt. 7,090
  3. Avatar for Vincera 134. Vincera Lv 1 1 pt. 6,810
  4. Avatar for 2707 135. 2707 Lv 1 1 pt. 6,545
  5. Avatar for pauldunn 136. pauldunn Lv 1 1 pt. 0
  6. Avatar for OliveTree 137. OliveTree Lv 1 1 pt. 0
  7. Avatar for nasalam2000 138. nasalam2000 Lv 1 1 pt. 0
  8. Avatar for JellyJump 139. JellyJump Lv 1 1 pt. 0

Comments