Placeholder image of a protein
Icon representing a puzzle

1586: Revisiting Puzzle 82: Cytotoxin

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,440
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 10,352
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 10,324
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,298
  5. Avatar for Go Science 5. Go Science 22 pts. 10,172
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 10,115
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,109
  8. Avatar for Contenders 8. Contenders 5 pts. 9,982
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,743
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 2 pts. 8,794

  1. Avatar for jamiexq 51. jamiexq Lv 1 11 pts. 9,634
  2. Avatar for anthion 52. anthion Lv 1 10 pts. 9,622
  3. Avatar for johnmitch 53. johnmitch Lv 1 10 pts. 9,594
  4. Avatar for Crossed Sticks 54. Crossed Sticks Lv 1 9 pts. 9,556
  5. Avatar for toshiue 55. toshiue Lv 1 9 pts. 9,543
  6. Avatar for manu8170 56. manu8170 Lv 1 8 pts. 9,536
  7. Avatar for orily1337 57. orily1337 Lv 1 8 pts. 9,516
  8. Avatar for pfirth 58. pfirth Lv 1 7 pts. 9,498
  9. Avatar for cbwest 59. cbwest Lv 1 7 pts. 9,455
  10. Avatar for MicElephant 60. MicElephant Lv 1 7 pts. 9,446

Comments