Placeholder image of a protein
Icon representing a puzzle

1588: 221-residue Cryo-EM Multi-Start with Density

Closed since over 7 years ago

Overall Prediction Electron Density

Summary


Created
October 16, 2018
Expires
Max points
100
Description

This is a repost of Puzzle 1579, now with electron density! Load in your Puzzle 1579 solutions and see if you can improve them to fit the density! We are giving you the same 5 server predictions as starting points, and over TWO WEEKS to work on this difficult target. Read the blogpost for more details.

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 5 pts. 10,343
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 9,878
  3. Avatar for Minions of TWIS 13. Minions of TWIS 2 pts. 9,429
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 9,309
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 1 pt. 9,011
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,295
  8. Avatar for HMT heritage 18. HMT heritage 1 pt. 7,612
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,929
  10. Avatar for Androids 20. Androids 1 pt. 6,846

  1. Avatar for icaru-5 191. icaru-5 Lv 1 1 pt. 0

Comments


beta_helix Staff Lv 1

NOTE: If you did not manually save a solution in Puzzle 1554, you can go back to 1554, manually save it, and the solution should appear in your manual saves for this puzzle.

Sequence:
SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

frood66 Lv 1

I did not expect to be able to play this puzzle.

I don't know what has been done - but it runs fine. It will never be the fastest running (given it's size and being ED)

Whatever has been done to make this playable - congrats to FC

Bruno Kestemont Lv 1

It's great that we had a plenty of time to play this one. I won't even have enough time to end it but I suppose it's ok for you scientists to evaluate our results afterwards.

fisherlr777 Lv 1

That was a lot of fun watching go science pass it back and forth and back and forth. 10 of the top 11 scores! Great work.