Placeholder image of a protein
Icon representing a puzzle

1588: 221-residue Cryo-EM Multi-Start with Density

Closed since over 7 years ago

Overall Prediction Electron Density

Summary


Created
October 16, 2018
Expires
Max points
100
Description

This is a repost of Puzzle 1579, now with electron density! Load in your Puzzle 1579 solutions and see if you can improve them to fit the density! We are giving you the same 5 server predictions as starting points, and over TWO WEEKS to work on this difficult target. Read the blogpost for more details.

Top groups



  1. Avatar for nicobul 31. nicobul Lv 1 43 pts. 14,383
  2. Avatar for pvc78 32. pvc78 Lv 1 42 pts. 14,324
  3. Avatar for Tehnologik1 33. Tehnologik1 Lv 1 40 pts. 14,112
  4. Avatar for robgee 34. robgee Lv 1 39 pts. 14,011
  5. Avatar for cbwest 35. cbwest Lv 1 38 pts. 13,961
  6. Avatar for jeff101 36. jeff101 Lv 1 37 pts. 13,954
  7. Avatar for silent gene 37. silent gene Lv 1 35 pts. 13,834
  8. Avatar for johnmitch 38. johnmitch Lv 1 34 pts. 13,789
  9. Avatar for Glen B 39. Glen B Lv 1 33 pts. 13,703
  10. Avatar for tyler0911 40. tyler0911 Lv 1 32 pts. 13,685

Comments


beta_helix Staff Lv 1

NOTE: If you did not manually save a solution in Puzzle 1554, you can go back to 1554, manually save it, and the solution should appear in your manual saves for this puzzle.

Sequence:
SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

frood66 Lv 1

I did not expect to be able to play this puzzle.

I don't know what has been done - but it runs fine. It will never be the fastest running (given it's size and being ED)

Whatever has been done to make this playable - congrats to FC

Bruno Kestemont Lv 1

It's great that we had a plenty of time to play this one. I won't even have enough time to end it but I suppose it's ok for you scientists to evaluate our results afterwards.

fisherlr777 Lv 1

That was a lot of fun watching go science pass it back and forth and back and forth. 10 of the top 11 scores! Great work.