Placeholder image of a protein
Icon representing a puzzle

1588: 221-residue Cryo-EM Multi-Start with Density

Closed since over 7 years ago

Overall Prediction Electron Density

Summary


Created
October 16, 2018
Expires
Max points
100
Description

This is a repost of Puzzle 1579, now with electron density! Load in your Puzzle 1579 solutions and see if you can improve them to fit the density! We are giving you the same 5 server predictions as starting points, and over TWO WEEKS to work on this difficult target. Read the blogpost for more details.

Top groups



  1. Avatar for orily1337 41. orily1337 Lv 1 31 pts. 13,278
  2. Avatar for weitzen 42. weitzen Lv 1 30 pts. 12,925
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 29 pts. 12,922
  4. Avatar for hpaege 44. hpaege Lv 1 28 pts. 12,840
  5. Avatar for vakobo 45. vakobo Lv 1 27 pts. 12,762
  6. Avatar for drjr 46. drjr Lv 1 26 pts. 12,689
  7. Avatar for dcrwheeler 47. dcrwheeler Lv 1 26 pts. 12,673
  8. Avatar for fpc 48. fpc Lv 1 25 pts. 12,637
  9. Avatar for smilingone 49. smilingone Lv 1 24 pts. 12,569
  10. Avatar for Jesse Pinkman 50. Jesse Pinkman Lv 1 23 pts. 12,380

Comments


beta_helix Staff Lv 1

NOTE: If you did not manually save a solution in Puzzle 1554, you can go back to 1554, manually save it, and the solution should appear in your manual saves for this puzzle.

Sequence:
SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

frood66 Lv 1

I did not expect to be able to play this puzzle.

I don't know what has been done - but it runs fine. It will never be the fastest running (given it's size and being ED)

Whatever has been done to make this playable - congrats to FC

Bruno Kestemont Lv 1

It's great that we had a plenty of time to play this one. I won't even have enough time to end it but I suppose it's ok for you scientists to evaluate our results afterwards.

fisherlr777 Lv 1

That was a lot of fun watching go science pass it back and forth and back and forth. 10 of the top 11 scores! Great work.