Placeholder image of a protein
Icon representing a puzzle

1588: 221-residue Cryo-EM Multi-Start with Density

Closed since over 7 years ago

Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
October 16, 2018
Expires
Max points
100
Description

This is a repost of Puzzle 1579, now with electron density! Load in your Puzzle 1579 solutions and see if you can improve them to fit the density! We are giving you the same 5 server predictions as starting points, and over TWO WEEKS to work on this difficult target. Read the blogpost for more details.

Top groups



  1. Avatar for asb4 51. asb4 Lv 1 22 pts. 12,185
  2. Avatar for Altercomp 52. Altercomp Lv 1 21 pts. 12,169
  3. Avatar for WBarme1234 53. WBarme1234 Lv 1 21 pts. 12,149
  4. Avatar for TastyMunchies 54. TastyMunchies Lv 1 20 pts. 12,065
  5. Avatar for Hellcat6 55. Hellcat6 Lv 1 19 pts. 12,059
  6. Avatar for jausmh 56. jausmh Lv 1 19 pts. 12,018
  7. Avatar for rinze 57. rinze Lv 1 18 pts. 11,947
  8. Avatar for Merf 58. Merf Lv 1 17 pts. 11,910
  9. Avatar for froggs554 59. froggs554 Lv 1 17 pts. 11,908
  10. Avatar for Maerlyn138 60. Maerlyn138 Lv 1 16 pts. 11,725

Comments


beta_helix Staff Lv 1

NOTE: If you did not manually save a solution in Puzzle 1554, you can go back to 1554, manually save it, and the solution should appear in your manual saves for this puzzle.

Sequence:
SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

frood66 Lv 1

I did not expect to be able to play this puzzle.

I don't know what has been done - but it runs fine. It will never be the fastest running (given it's size and being ED)

Whatever has been done to make this playable - congrats to FC

Bruno Kestemont Lv 1

It's great that we had a plenty of time to play this one. I won't even have enough time to end it but I suppose it's ok for you scientists to evaluate our results afterwards.

fisherlr777 Lv 1

That was a lot of fun watching go science pass it back and forth and back and forth. 10 of the top 11 scores! Great work.