Placeholder image of a protein
Icon representing a puzzle

1588: 221-residue Cryo-EM Multi-Start with Density

Closed since over 7 years ago

Overall Prediction Electron Density

Summary


Created
October 16, 2018
Expires
Max points
100
Description

This is a repost of Puzzle 1579, now with electron density! Load in your Puzzle 1579 solutions and see if you can improve them to fit the density! We are giving you the same 5 server predictions as starting points, and over TWO WEEKS to work on this difficult target. Read the blogpost for more details.

Top groups


  1. Avatar for Go Science 100 pts. 22,360
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 22,291
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 22,267
  4. Avatar for Marvin's bunch 4. Marvin's bunch 49 pts. 21,986
  5. Avatar for Contenders 5. Contenders 37 pts. 17,747
  6. Avatar for Gargleblasters 6. Gargleblasters 28 pts. 16,785
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 15,708
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 15,584
  9. Avatar for Russian team 9. Russian team 11 pts. 12,762
  10. Avatar for freefolder 10. freefolder 8 pts. 12,169

  1. Avatar for Cyberkashi 91. Cyberkashi Lv 1 5 pts. 9,586
  2. Avatar for SouperGenious 92. SouperGenious Lv 1 4 pts. 9,508
  3. Avatar for Mike Cassidy 93. Mike Cassidy Lv 1 4 pts. 9,504
  4. Avatar for Squirrely 94. Squirrely Lv 1 4 pts. 9,482
  5. Avatar for dbuske 95. dbuske Lv 1 4 pts. 9,454
  6. Avatar for gldisater 96. gldisater Lv 1 4 pts. 9,429
  7. Avatar for JasperD 97. JasperD Lv 1 3 pts. 9,309
  8. Avatar for Gahmeir 98. Gahmeir Lv 1 3 pts. 9,307
  9. Avatar for Deleted player 99. Deleted player pts. 9,274
  10. Avatar for GUANINJIN 100. GUANINJIN Lv 1 3 pts. 9,267

Comments


beta_helix Staff Lv 1

NOTE: If you did not manually save a solution in Puzzle 1554, you can go back to 1554, manually save it, and the solution should appear in your manual saves for this puzzle.

Sequence:
SKLTLNAWKDREGKIPAGSMSAMYNPETIQLDYQTRFDTEDTINTASQ
SNRYVISEPVGLNLTLLFDSQMPGNTTPIETQLAMLKSLCAVDAATGSP
YFLRITWGKMRWENKGWFAGRARDLSVTYTLFDRDATPLRATVQLSL
VADESFVIQQSLKTQSAPDRALVSVPDLASLPLLALSAGGVLASSVDYL
SLAWDNDLDNLDDFQTGDFLRATKGEEV

frood66 Lv 1

I did not expect to be able to play this puzzle.

I don't know what has been done - but it runs fine. It will never be the fastest running (given it's size and being ED)

Whatever has been done to make this playable - congrats to FC

Bruno Kestemont Lv 1

It's great that we had a plenty of time to play this one. I won't even have enough time to end it but I suppose it's ok for you scientists to evaluate our results afterwards.

fisherlr777 Lv 1

That was a lot of fun watching go science pass it back and forth and back and forth. 10 of the top 11 scores! Great work.