Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,911
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,233
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 7,962
  4. Avatar for freefolder 14. freefolder 1 pt. 7,295
  5. Avatar for Weber Tropical Diseases 15. Weber Tropical Diseases 1 pt. 7,157
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,364
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,326
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 93 pts. 10,190
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 90 pts. 10,184
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 87 pts. 10,173
  6. Avatar for johnmitch 6. johnmitch Lv 1 83 pts. 10,136
  7. Avatar for tyler0911 7. tyler0911 Lv 1 80 pts. 10,108
  8. Avatar for frood66 8. frood66 Lv 1 77 pts. 10,106
  9. Avatar for Blipperman 9. Blipperman Lv 1 74 pts. 10,104
  10. Avatar for silent gene 10. silent gene Lv 1 72 pts. 10,104

Comments