Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Go Science 100 pts. 10,364
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,326
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,173
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,130
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,118
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,104
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,058
  8. Avatar for Contenders 8. Contenders 4 pts. 9,863
  9. Avatar for HMT heritage 9. HMT heritage 2 pts. 9,505
  10. Avatar for Russian team 10. Russian team 1 pt. 8,958

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,364
  2. Avatar for Hollinas 2. Hollinas Lv 1 79 pts. 10,360
  3. Avatar for Maerlyn138 3. Maerlyn138 Lv 1 61 pts. 10,360
  4. Avatar for LociOiling 4. LociOiling Lv 1 47 pts. 10,326
  5. Avatar for reefyrob 5. reefyrob Lv 1 35 pts. 10,324
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 26 pts. 10,324
  7. Avatar for silent gene 7. silent gene Lv 1 19 pts. 10,321
  8. Avatar for smilingone 8. smilingone Lv 1 14 pts. 10,306
  9. Avatar for dbuske 9. dbuske Lv 1 10 pts. 10,188
  10. Avatar for toshiue 10. toshiue Lv 1 7 pts. 10,175

Comments