Placeholder image of a protein
Icon representing a puzzle

1591: Revisiting Puzzle 83: Cardiotoxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
October 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,364
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,326
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,173
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,130
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,118
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,104
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,058
  8. Avatar for Contenders 8. Contenders 4 pts. 9,863
  9. Avatar for HMT heritage 9. HMT heritage 2 pts. 9,505
  10. Avatar for Russian team 10. Russian team 1 pt. 8,958
  1. Avatar for nicobul 21. nicobul Lv 1 46 pts. 9,911
  2. Avatar for Vinara 22. Vinara Lv 1 44 pts. 9,886
  3. Avatar for MicElephant 23. MicElephant Lv 1 42 pts. 9,876
  4. Avatar for phi16 24. phi16 Lv 1 40 pts. 9,870
  5. Avatar for Maerlyn138 25. Maerlyn138 Lv 1 38 pts. 9,864
  6. Avatar for Mark- 26. Mark- Lv 1 37 pts. 9,863
  7. Avatar for gdnskye 27. gdnskye Lv 1 35 pts. 9,859
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 34 pts. 9,819
  9. Avatar for robgee 29. robgee Lv 1 32 pts. 9,794
  10. Avatar for aznarog 30. aznarog Lv 1 31 pts. 9,786

Comments