Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 4 pts. 9,033
  2. Avatar for Czech National Team 12. Czech National Team 2 pts. 8,704
  3. Avatar for freefolder 13. freefolder 2 pts. 8,649
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,344
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 7,781
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,591
  8. Avatar for cit 18. cit 1 pt. 7,323
  9. Avatar for test_group1 19. test_group1 1 pt. 4,094
  10. Avatar for AST Biology 20. AST Biology 1 pt. 4,094

  1. Avatar for tyler0911
    1. tyler0911 Lv 1
    100 pts. 11,284
  2. Avatar for Mark- 2. Mark- Lv 1 97 pts. 11,044
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 94 pts. 11,009
  4. Avatar for Skippysk8s 4. Skippysk8s Lv 1 91 pts. 10,977
  5. Avatar for LociOiling 5. LociOiling Lv 1 88 pts. 10,909
  6. Avatar for Galaxie 6. Galaxie Lv 1 85 pts. 10,863
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 82 pts. 10,859
  8. Avatar for nicobul 8. nicobul Lv 1 79 pts. 10,854
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 77 pts. 10,812
  10. Avatar for actiasluna 10. actiasluna Lv 1 74 pts. 10,802

Comments