Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 4 pts. 9,033
  2. Avatar for Czech National Team 12. Czech National Team 2 pts. 8,704
  3. Avatar for freefolder 13. freefolder 2 pts. 8,649
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,344
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 7,781
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,591
  8. Avatar for cit 18. cit 1 pt. 7,323
  9. Avatar for test_group1 19. test_group1 1 pt. 4,094
  10. Avatar for AST Biology 20. AST Biology 1 pt. 4,094
  1. Avatar for deLaCeiba 111. deLaCeiba Lv 1 1 pt. 7,781
  2. Avatar for fuzzyeyed 112. fuzzyeyed Lv 1 1 pt. 7,722
  3. Avatar for Perhonen 113. Perhonen Lv 1 1 pt. 7,712
  4. Avatar for PregnantPickle 114. PregnantPickle Lv 1 1 pt. 7,681
  5. Avatar for riyuch4 115. riyuch4 Lv 1 1 pt. 7,678
  6. Avatar for lamoille 116. lamoille Lv 1 1 pt. 7,634
  7. Avatar for nataliesnowwww 117. nataliesnowwww Lv 1 1 pt. 7,613
  8. Avatar for Aseret 118. Aseret Lv 1 1 pt. 7,600
  9. Avatar for Savas 119. Savas Lv 1 1 pt. 7,591
  10. Avatar for multaq 120. multaq Lv 1 1 pt. 7,517

Comments