Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 4 pts. 9,033
  2. Avatar for Czech National Team 12. Czech National Team 2 pts. 8,704
  3. Avatar for freefolder 13. freefolder 2 pts. 8,649
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,344
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 7,781
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,591
  8. Avatar for cit 18. cit 1 pt. 7,323
  9. Avatar for test_group1 19. test_group1 1 pt. 4,094
  10. Avatar for AST Biology 20. AST Biology 1 pt. 4,094
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 72 pts. 10,784
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 69 pts. 10,767
  3. Avatar for frood66 13. frood66 Lv 1 67 pts. 10,705
  4. Avatar for hpaege 14. hpaege Lv 1 64 pts. 10,689
  5. Avatar for jamiexq 15. jamiexq Lv 1 62 pts. 10,687
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 60 pts. 10,668
  7. Avatar for gdnskye 17. gdnskye Lv 1 58 pts. 10,644
  8. Avatar for jobo0502 18. jobo0502 Lv 1 56 pts. 10,599
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 54 pts. 10,560
  10. Avatar for YeshuaLives 20. YeshuaLives Lv 1 52 pts. 10,556

Comments