Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 4 pts. 9,033
  2. Avatar for Czech National Team 12. Czech National Team 2 pts. 8,704
  3. Avatar for freefolder 13. freefolder 2 pts. 8,649
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,605
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,344
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 7,781
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,591
  8. Avatar for cit 18. cit 1 pt. 7,323
  9. Avatar for test_group1 19. test_group1 1 pt. 4,094
  10. Avatar for AST Biology 20. AST Biology 1 pt. 4,094

  1. Avatar for Idiotboy 31. Idiotboy Lv 1 34 pts. 10,300
  2. Avatar for Hellcat6 32. Hellcat6 Lv 1 32 pts. 10,259
  3. Avatar for Flagg65a 33. Flagg65a Lv 1 31 pts. 10,257
  4. Avatar for aznarog 34. aznarog Lv 1 30 pts. 10,197
  5. Avatar for vakobo 35. vakobo Lv 1 29 pts. 10,153
  6. Avatar for MicElephant 36. MicElephant Lv 1 28 pts. 10,133
  7. Avatar for Marvelz 37. Marvelz Lv 1 26 pts. 10,128
  8. Avatar for silent gene 38. silent gene Lv 1 25 pts. 10,114
  9. Avatar for guineapig 39. guineapig Lv 1 24 pts. 10,036
  10. Avatar for Glen B 40. Glen B Lv 1 23 pts. 10,006

Comments