Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 4,094
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,311
  2. Avatar for Deleted player 2. Deleted player pts. 11,299
  3. Avatar for phi16 3. phi16 Lv 1 70 pts. 11,293
  4. Avatar for robgee 4. robgee Lv 1 57 pts. 11,289
  5. Avatar for tyler0911 5. tyler0911 Lv 1 47 pts. 11,271
  6. Avatar for jamiexq 6. jamiexq Lv 1 38 pts. 11,248
  7. Avatar for lamoille 7. lamoille Lv 1 30 pts. 11,116
  8. Avatar for gdnskye 8. gdnskye Lv 1 24 pts. 11,107
  9. Avatar for LociOiling 9. LociOiling Lv 1 19 pts. 11,022
  10. Avatar for smilingone 10. smilingone Lv 1 15 pts. 11,020

Comments