Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 4,094
  1. Avatar for Moss Kirin 101. Moss Kirin Lv 1 1 pt. 8,103
  2. Avatar for sydlg19 102. sydlg19 Lv 1 1 pt. 8,087
  3. Avatar for momadoc 103. momadoc Lv 1 1 pt. 8,046
  4. Avatar for PlagueRat 104. PlagueRat Lv 1 1 pt. 8,031
  5. Avatar for Threeoak 105. Threeoak Lv 1 1 pt. 7,925
  6. Avatar for justjustin 106. justjustin Lv 1 1 pt. 7,898
  7. Avatar for GUANINJIN 107. GUANINJIN Lv 1 1 pt. 7,889
  8. Avatar for tomerpar 108. tomerpar Lv 1 1 pt. 7,855
  9. Avatar for bblattmann 109. bblattmann Lv 1 1 pt. 7,853
  10. Avatar for alwen 110. alwen Lv 1 1 pt. 7,840

Comments