Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 4,094
  1. Avatar for johnmitch 21. johnmitch Lv 1 50 pts. 10,549
  2. Avatar for katling 22. katling Lv 1 48 pts. 10,544
  3. Avatar for Blipperman 23. Blipperman Lv 1 46 pts. 10,538
  4. Avatar for diamonddays 24. diamonddays Lv 1 45 pts. 10,528
  5. Avatar for fpc 25. fpc Lv 1 43 pts. 10,519
  6. Avatar for pvc78 26. pvc78 Lv 1 41 pts. 10,469
  7. Avatar for bertro 27. bertro Lv 1 40 pts. 10,453
  8. Avatar for robgee 28. robgee Lv 1 38 pts. 10,448
  9. Avatar for georg137 29. georg137 Lv 1 37 pts. 10,433
  10. Avatar for Vinara 30. Vinara Lv 1 35 pts. 10,393

Comments