Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 4,094

  1. Avatar for WBarme1234 51. WBarme1234 Lv 1 14 pts. 9,712
  2. Avatar for dd-2 52. dd-2 Lv 1 13 pts. 9,705
  3. Avatar for O Seki To 53. O Seki To Lv 1 13 pts. 9,520
  4. Avatar for TastyMunchies 54. TastyMunchies Lv 1 12 pts. 9,499
  5. Avatar for ClassicShyGuy 55. ClassicShyGuy Lv 1 12 pts. 9,430
  6. Avatar for antibot215 56. antibot215 Lv 1 11 pts. 9,406
  7. Avatar for georged 57. georged Lv 1 11 pts. 9,270
  8. Avatar for heather-1 58. heather-1 Lv 1 10 pts. 9,266
  9. Avatar for manu8170 59. manu8170 Lv 1 10 pts. 9,236
  10. Avatar for icaru-5 60. icaru-5 Lv 1 9 pts. 9,211

Comments