Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 4,094

  1. Avatar for mnucer 61. mnucer Lv 1 9 pts. 9,157
  2. Avatar for ManVsYard 62. ManVsYard Lv 1 8 pts. 9,139
  3. Avatar for Deleted player 63. Deleted player pts. 9,082
  4. Avatar for ComputerMage 64. ComputerMage Lv 1 7 pts. 9,076
  5. Avatar for ourtown 65. ourtown Lv 1 7 pts. 9,074
  6. Avatar for toshiue 66. toshiue Lv 1 7 pts. 9,048
  7. Avatar for alyssa_d 67. alyssa_d Lv 1 6 pts. 9,033
  8. Avatar for dpmattingly 68. dpmattingly Lv 1 6 pts. 9,031
  9. Avatar for Wojcimierz 69. Wojcimierz Lv 1 6 pts. 9,023
  10. Avatar for rinze 70. rinze Lv 1 5 pts. 8,990

Comments